PDB entry 3g7f

View 3g7f on RCSB PDB site
Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center
Class: photosynthesis
Keywords: Heterodimer mutant, Blastochloris viridis, photosynthetic reaction center, membrane protein structure, microfluidics, plugs, Cell membrane, Electron transport, Heme, Iron, Lipoprotein, Membrane, Metal-binding, Photosynthesis, Reaction center, Transport, Bacteriochlorophyll, Chlorophyll, Chromophore, Formylation, Transmembrane, Magnesium
Deposited on 2009-02-09, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g7fc_
  • Chain 'H':
    Compound: Photosynthetic reaction center H subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06008 (0-257)
      • variant (215)
      • variant (255)
    Domains in SCOPe 2.07: d3g7fh1, d3g7fh2
  • Chain 'L':
    Compound: Photosynthetic reaction center L subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g7fl_
  • Chain 'M':
    Compound: Photosynthetic reaction center M subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06010 (0-322)
      • variant (199)
    Domains in SCOPe 2.07: d3g7fm_
  • Heterogens: HEC, SO4, HTO, LDA, BCB, BPB, UQ1, FE2, MQ9, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g7fC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g7fC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3g7fH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilsdqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaeall
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g7fH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplvepedgqvyelpypktf
    vlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaeraevvdatv
    dgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyfrylelsva
    gsartaliplgfcdvkkdkivvtsilsdqfanvprlqsrdqitlreedkvsayyagglly
    atperaeall
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g7fL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g7fM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwlgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk