PDB entry 3g75

View 3g75 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus Gyrase B co-complexed with 4-METHYL-5-[3-(METHYLSULFANYL)-1H-PYRAZOL-5-YL]-2-THIOPHEN-2-YL-1,3-THIAZOLE inhibitor
Class: Isomerase/Isomerase inhibitor
Keywords: Antibiotic resistance, Isomerase, Isomerase-Isomerase inhibitor complex
Deposited on 2009-02-09, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g75a_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g75b_
  • Heterogens: B48, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g75A (A:)
    gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
    rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
    ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
    yhye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g75B (B:)
    gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
    rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
    ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
    yhye