PDB entry 3g6j

View 3g6j on RCSB PDB site
Description: C3b in complex with a C3b specific Fab
Class: immune system
Keywords: Complement, C3b, Fab, Antibody:Antigen, Age-related macular degeneration, Cleavage on pair of basic residues, Complement alternate pathway, Complement pathway, Disease mutation, Glycoprotein, Immune response, Inflammatory response, Innate immunity, Phosphoprotein, Secreted, Thioester bond, IMMUNE SYSTEM
Deposited on 2009-02-06, released 2009-03-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Complement C3 beta chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (0-End)
• Chain 'B':
  Compound: Complement C3 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (Start-914)
• Chain 'C':
  Compound: Complement C3 beta chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (0-End)
• Chain 'D':
  Compound: Complement C3 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (Start-914)
• Chain 'E':
  Compound: Fab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3G6J (0-213)
  Domains in SCOPe 2.04: d3g6je1, d3g6je2
• Chain 'F':
  Compound: Fab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3G6J (0-225)
• Chain 'G':
  Compound: Fab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3G6J (0-213)
  Domains in SCOPe 2.04: d3g6jg1, d3g6jg2
• Chain 'H':
  Compound: Fab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3G6J (0-225)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3g6jE (E:)
  diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
  rfsgsgsgtdftltisslqpedfatyycqqsyatlptfeqgtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3g6jG (G:)
  diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
  rfsgsgsgtdftltisslqpedfatyycqqsyatlptfeqgtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'H':
  No sequence available.