PDB entry 3g6h

View 3g6h on RCSB PDB site
Description: Src Thr338Ile inhibited in the DFG-Asp-Out conformation
Class: transferase
Keywords: Cancer, imatinib resistance, DSA compounds, kinase, DFG-Asp-Out, Alternative splicing, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2009-02-06, released 2009-03-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.228
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
    Domains in SCOPe 2.03: d3g6ha_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
    Domains in SCOPe 2.03: d3g6hb_
  • Heterogens: G6H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g6hA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivieymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6hA (A:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivieymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarliekfpikwtapeaalygrftiksdvws
    fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerp
    tfeylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g6hB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivieymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6hB (B:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivieymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglpikwtapeaalygrftiksdvwsfgillte
    lttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqa
    fledyftstepqyqpgenl