PDB entry 3g6g

View 3g6g on RCSB PDB site
Description: Equally potent inhibition of c-Src and Abl by compounds that recognize inactive kinase conformations
Class: transferase
Keywords: Cancer, imatinib resistance, DSA compounds, kinase, DFG-Asp-Out, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2009-02-06, released 2009-03-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g6ga_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g6gb_
  • Heterogens: G6G, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g6gA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6gA (A:)
    akdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmk
    klrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgma
    yvermnyvhrdlraanilvgenlvckvadfggakfpikwtapeaalygrftiksdvwsfg
    illtelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptf
    eylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g6gB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6gB (B:)
    akdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmk
    klrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgma
    yvermnyvhrdlraanilvgenlvckvadfgakfpikwtapeaalygrftiksdvwsfgi
    lltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfe
    ylqafledyftstepqyqpgenl