PDB entry 3g5x

View 3g5x on RCSB PDB site
Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2009-02-05, released 2009-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 806 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5X (0-213)
    Domains in SCOPe 2.07: d3g5xa1, d3g5xa2
  • Chain 'B':
    Compound: 806 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5X (0-215)
  • Chain 'C':
    Compound: 806 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5X (0-213)
    Domains in SCOPe 2.07: d3g5xc1, d3g5xc2
  • Chain 'D':
    Compound: 806 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5X (0-215)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g5xA (A:)
    dilmtqspssmsvslgdtvsitchssqdinsnigwlqqkpgksfkgliyhgtnlddevps
    rfsgsgsgadysltisslesedfadyycvqyaqfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g5xC (C:)
    dilmtqspssmsvslgdtvsitchssqdinsnigwlqqkpgksfkgliyhgtnlddevps
    rfsgsgsgadysltisslesedfadyycvqyaqfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.