PDB entry 3g5g

View 3g5g on RCSB PDB site
Description: Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I
Class: transcription regulator
Keywords: transcriptional regulator, helix-turn-helix, Restriction-modification, TRANSCRIPTION REGULATOR
Deposited on 2009-02-05, released 2009-08-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5ga_
  • Chain 'B':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gb_
  • Chain 'C':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gc_
  • Chain 'D':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gd_
  • Chain 'E':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5ge_
  • Chain 'F':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gf_
  • Chain 'G':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gg_
  • Chain 'H':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gh_
  • Chain 'I':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gi_
  • Chain 'J':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gj_
  • Chain 'K':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gk_
  • Chain 'L':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gl_
  • Chain 'M':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gm_
  • Chain 'N':
    Compound: Regulatory protein
    Species: Enterobacter sp. [TaxId:211595]
    Gene: esp1396IC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3g5gn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g5gA (A:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gA (A:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g5gB (B:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gB (B:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g5gC (C:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gC (C:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g5gD (D:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gD (D:)
    sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
    sdvvffemlikeilkhd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3g5gE (E:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gE (E:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3g5gF (F:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gF (F:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3g5gG (G:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gG (G:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3g5gH (H:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gH (H:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkhd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3g5gI (I:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gI (I:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3g5gJ (J:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gJ (J:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilkhd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3g5gK (K:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gK (K:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3g5gL (L:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gL (L:)
    esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
    vsdvvffemlikeilk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3g5gM (M:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gM (M:)
    mesfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgl
    evsdvvffemlikeilk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3g5gN (N:)
    mgsshhhhhhssglvprgshmesfllskvsfvikkirlekgmtqedlayksnldrtyisg
    iernsrnltikslelimkglevsdvvffemlikeilkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5gN (N:)
    sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
    sdvvffemlikeilk