PDB entry 3g4t

View 3g4t on RCSB PDB site
Description: Mth0212 (WT) in complex with a 7bp dsDNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, double-stranded DNA, inorganic phosphate, Mg2+, HYDROLASE-DNA COMPLEX
Deposited on 2009-02-04, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g4ta_
  • Chain 'B':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (0-End)
      • engineered mutation (1)
    Domains in SCOPe 2.07: d3g4tb_
  • Chain 'H':
    Compound: 5'-d(*cp*gp*tp*ap*(ups)p*tp*ap*cp*g)-3'
  • Chain 'I':
    Compound: 5'-d(*cp*g*tp*ap*cp*tp*ap*cp*g)-3'
  • Heterogens: PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g4tA (A:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4tA (A:)
    vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
    aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
    kyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawid
    kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
    vmgsdhcpigleie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g4tB (B:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4tB (B:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpiglei
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.