PDB entry 3g4f

View 3g4f on RCSB PDB site
Description: Crystal Structure of (+)- -Cadinene Synthase from Gossypium arboreum in complex with 2-fluorofarnesyl diphosphate
Class: lyase
Keywords: Cyclase, Lyase, Magnesium, Metal-binding
Deposited on 2009-02-03, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (+)-delta-cadinene synthase isozyme XC1
    Species: Gossypium arboreum [TaxId:29729]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g4fa1, d3g4fa2
  • Chain 'B':
    Compound: (+)-delta-cadinene synthase isozyme XC1
    Species: Gossypium arboreum [TaxId:29729]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g4fb1, d3g4fb2
  • Heterogens: BME, FPF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g4fA (A:)
    masqvsqmpsssplssnkdemrpkadfqpsiwgdlflncpdknidaetekrhqqlkeevr
    kmivapmanstqklafidsvqrlgvsyhftkeiedeleniyhnnndaendlyttsirfrl
    lrehgynvscdvfnkfkdeqgnfkssvtsdvrgllelyqasylrvhgedildeaisftth
    hlslavasldhplseevshalkqsirrglprvearhylsvyqdieshnkallefakidfn
    mlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfepqyslgrkmltkvi
    amasivddtydsyatyeelipytnaierwdikcideipeymkpsykalldvyeemvqlva
    ehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalptcgyamlaitsfvg
    mgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddcsaiecymeeygvta
    qeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyregdgytyvgkaa
    kggitslliepial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4fA (A:)
    adfqpsiwgdlflncpddaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
    hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
    tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
    glprvearhylsvyqdeshnkallefakidfnmlqflhrkelseicrwwkdldfqrklpy
    ardrvvegyfwisgvyfepqyslgrkmltkviamasivddtydsyatyeelipytnaier
    wdikcideipeymkpsykalldvyeemvqlvaehgrqyrveyaknamirlaqsylveakw
    tlqnykpsfeefkanalptcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicr
    fmddvaehkfdcsaiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevln
    rslnlarvmdvlyreyvgkaakggitslliepial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g4fB (B:)
    masqvsqmpsssplssnkdemrpkadfqpsiwgdlflncpdknidaetekrhqqlkeevr
    kmivapmanstqklafidsvqrlgvsyhftkeiedeleniyhnnndaendlyttsirfrl
    lrehgynvscdvfnkfkdeqgnfkssvtsdvrgllelyqasylrvhgedildeaisftth
    hlslavasldhplseevshalkqsirrglprvearhylsvyqdieshnkallefakidfn
    mlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfepqyslgrkmltkvi
    amasivddtydsyatyeelipytnaierwdikcideipeymkpsykalldvyeemvqlva
    ehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalptcgyamlaitsfvg
    mgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddcsaiecymeeygvta
    qeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyregdgytyvgkaa
    kggitslliepial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4fB (B:)
    adfqpsiwgdlflncpddaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
    hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
    tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
    glprvearhylsvyqdeshnkallefakidfnmlqflhrkelseicrwwkdldfqrklpy
    ardrvvegyfwisgvyfepqyslgrkmltkviamasivddtydsyatyeelipytnaier
    wdikcideipeymkpsykalldvyeemvqlvaehgrqyrveyaknamirlaqsylveakw
    tlqnykpsfeefkanalptcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicr
    fmddvaehkfdcsaiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevln
    rslnlarvmdvlyreyvgkaakggitslliepial