PDB entry 3g4d

View 3g4d on RCSB PDB site
Description: Crystal Structure of (+)-delta-Cadinene Synthase from Gossypium arboreum and Evolutionary Divergence of Metal Binding Motifs for Catalysis
Class: lyase
Keywords: cyclase, Lyase, Magnesium, Metal-binding
Deposited on 2009-02-03, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (+)-delta-cadinene synthase isozyme XC1
    Species: Gossypium arboreum [TaxId:29729]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g4da1, d3g4da2
  • Chain 'B':
    Compound: (+)-delta-cadinene synthase isozyme XC1
    Species: Gossypium arboreum [TaxId:29729]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g4db1, d3g4db2
  • Heterogens: BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g4dA (A:)
    masqvsqmpsssplssnkdemrpkadfqpsiwgdlflncpdknidaetekrhqqlkeevr
    kmivapmanstqklafidsvqrlgvsyhftkeiedeleniyhnnndaendlyttsirfrl
    lrehgynvscdvfnkfkdeqgnfkssvtsdvrgllelyqasylrvhgedildeaisftth
    hlslavasldhplseevshalkqsirrglprvearhylsvyqdieshnkallefakidfn
    mlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfepqyslgrkmltkvi
    amasivddtydsyatyeelipytnaierwdikcideipeymkpsykalldvyeemvqlva
    ehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalptcgyamlaitsfvg
    mgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddcsaiecymeeygvta
    qeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyregdgytyvgkaa
    kggitslliepial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4dA (A:)
    adfqpsiwgdlflncpddaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
    hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
    tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
    glprvearhylsvyqdieshnkallefakidfnmlqflhrkelseicrwwkdldfqrklp
    yardrvvegyfwisgvyfepqyslgrkmltkviamasivddtydsyatyeelipytnaie
    rwdikcideipeymkpsykalldvyeemvqlvaehgrqyrveyaknamirlaqsylveak
    wtlqnykpsfeefkanalptcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiic
    rfmddvaehkfdcsaiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevl
    nrslnlarvmdvlyreyvgkaakggitslliepial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g4dB (B:)
    masqvsqmpsssplssnkdemrpkadfqpsiwgdlflncpdknidaetekrhqqlkeevr
    kmivapmanstqklafidsvqrlgvsyhftkeiedeleniyhnnndaendlyttsirfrl
    lrehgynvscdvfnkfkdeqgnfkssvtsdvrgllelyqasylrvhgedildeaisftth
    hlslavasldhplseevshalkqsirrglprvearhylsvyqdieshnkallefakidfn
    mlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfepqyslgrkmltkvi
    amasivddtydsyatyeelipytnaierwdikcideipeymkpsykalldvyeemvqlva
    ehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalptcgyamlaitsfvg
    mgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddcsaiecymeeygvta
    qeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyregdgytyvgkaa
    kggitslliepial
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4dB (B:)
    qpsiwgdlflncpdkniaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsyh
    ftkeiedeleniyhnndlyttsirfrllrehgynvscdvfnkfkdeqgnfkssvtsdvrg
    llelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirrglprve
    arhylsvyqdieshnkallefakidfnmlqflhrkelseicrwwkdldfqrklpyardrv
    vegyfwisgvyfepqyslgrkmltkviamasivddtydsyatyeelipytnaierwdikc
    ideipeymkpsykalldvyeemvqlvaehgrqyrveyaknamirlaqsylveakwtlqny
    kpsfeefkanalptcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicrfmddv
    aehkfkdcsaiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevlnrsln
    larvmdvlyregdggkaakggitslliepial