PDB entry 3g48

View 3g48 on RCSB PDB site
Description: Crystal structure of chaperone CsaA form Bacillus anthracis str. Ames
Class: protein transport
Keywords: chaperone CsaA, CsaA, Structural Genomics, NIAID Structural Genomic Centers for Infectious Diseases, Center for Structural Genomics of Infectious Diseases, PROTEIN TRANSPORT, CSGID
Deposited on 2009-02-03, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone CsaA
    Species: Bacillus anthracis [TaxId:1392]
    Gene: csaA, BAS1917, BA_2064, GBAA2064
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81RI2 (3-111)
      • expression tag (2)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d3g48a1, d3g48a2
  • Chain 'B':
    Compound: Chaperone CsaA
    Species: Bacillus anthracis [TaxId:1392]
    Gene: csaA, BAS1917, BA_2064, GBAA2064
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81RI2 (3-111)
      • expression tag (2)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d3g48b1, d3g48b2
  • Heterogens: EDO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g48A (A:)
    snamanfedfltldlrigtvthaeefkearvpairleidfgelgmkqssaqitkrynped
    ligqqivavvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g48A (A:)
    amanfedfltldlrigtvthaeefkearvpairleidfgelgmkqssaqitkrynpedli
    gqqivavvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g48B (B:)
    snamanfedfltldlrigtvthaeefkearvpairleidfgelgmkqssaqitkrynped
    ligqqivavvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g48B (B:)
    amanfedfltldlrigtvthaeefpairleidfgelgmkqssaqitkrynpedligqqiv
    avvnfppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis