PDB entry 3g3c

View 3g3c on RCSB PDB site
Description: Mth0212 (WT) in complex with a 6bp dsDNA containing a single one nucleotide long 3'-overhang
Class: hydrolase/DNA
Keywords: protein-DNA complex, HYDROLASE-DNA COMPLEX
Deposited on 2009-02-02, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314
      • engineered mutation (1)
    Domains in SCOPe 2.07: d3g3ca_
  • Chain 'B':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-256)
      • engineered mutation (1)
      • expression tag (257)
    Domains in SCOPe 2.07: d3g3cb1, d3g3cb2
  • Chain 'H':
    Compound: 5'-d(*cp*gp*tp*ap*cp*tp*ap*cp*g)-3'
  • Chain 'I':
    Compound: 5'-d(*cp*gp*tp*ap*(ups)p*tp*ap*cp*g)-3'
  • Heterogens: PO4, MG, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g3cA (A:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g3cA (A:)
    avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g3cB (B:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g3cB (B:)
    avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleiell
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.