PDB entry 3g38

View 3g38 on RCSB PDB site
Description: The catalytically inactive mutant Mth0212 (D151N) in complex with an 8 bp dsDNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, 3'- phosphate moiety bound, HYDROLASE-DNA COMPLEX
Deposited on 2009-02-02, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-256)
      • engineered mutation (1)
      • engineered mutation (150)
      • expression tag (257)
    Domains in SCOPe 2.07: d3g38a1, d3g38a2
  • Chain 'G':
    Compound: 5'-d(*cp*cp*tp*gp*up*gp*cp*gp*ap*t)-3'
  • Chain 'K':
    Compound: 5'-d(*cp*gp*cp*gp*cp*ap*gp*gp*c)-3'
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g38A (A:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g38A (A:)
    avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleiell
    

  • Chain 'G':
    No sequence available.

  • Chain 'K':
    No sequence available.