PDB entry 3g28

View 3g28 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of the Rous Sarcoma Virus capsid protein: mutant D179N, low pH
Class: viral protein
Keywords: alpha-helical bundle, capsid protein, virion, viral protein, retrovirus
Deposited on 2009-01-30, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.162
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03322 (0-76)
      • engineered (29)
    Domains in SCOPe 2.06: d3g28a_
  • Heterogens: NO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g28A (A:)
    agpwadimqgpsesfvdfanrlikavegsnlppsarapviidcfrqksqpdiqqlirtap
    stlttpgeiikyvldrq