PDB entry 3g26

View 3g26 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of the Rous Sarcoma Virus capsid protein: Mutant A184C
Class: viral protein
Keywords: alpha-helical bundle, capsid protein, virion, viral protein, retrovirus
Deposited on 2009-01-30, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein
  Species: Rous sarcoma virus [TaxId:11888]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03322 (0-76)
    • engineered (34)
  Domains in SCOPe 2.06: d3g26a_
• Heterogens: MLA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3g26A (A:)
  agpwadimqgpsesfvdfanrlikavegsdlppscrapviidcfrqksqpdiqqlirtap
  stlttpgeiikyvldrq