PDB entry 3g0c

View 3g0c on RCSB PDB site
Description: Crystal structure of dipeptidyl peptidase IV in complex with a pyrimidinedione inhibitor 1
Class: hydrolase/hydrolase inhibitor
Keywords: DPP4, pyrimidinone, pyrimidindione, Aminopeptidase, Cell membrane, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Serine protease, Signal-anchor, Transmembrane, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2009-01-27, released 2010-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g0ca1, d3g0ca2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (12-739)
      • expression tag (9-11)
    Domains in SCOPe 2.06: d3g0cb1, d3g0cb2, d3g0cb3
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g0cc1, d3g0cc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g0cd1, d3g0cd2
  • Heterogens: RUF, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0cA (A:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0cA (A:)
    ktytltdylkntyrlklyslrwisdheylyknilvfnaeygnssvflenstfdefghsin
    dysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghk
    layvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtfl
    ayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtnat
    siqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclvar
    qhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwe
    vigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfsk
    eakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetk
    fwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgs
    gyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsg
    sgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveylli
    hgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcf
    slp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g0cB (B:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0cB (B:)
    hhhsrktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfde
    fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
    spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
    pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
    svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
    nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
    tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
    svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfi
    ilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivas
    fdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvts
    mvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkq
    veyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmsh
    fikqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g0cC (C:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0cC (C:)
    ktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefghsi
    ndysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvgh
    klayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtf
    layaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtna
    tsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclva
    rqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtw
    evigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfs
    keakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnet
    kfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrg
    sgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgs
    gsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyll
    ihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqc
    fslp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g0cD (D:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0cD (D:)
    ktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefghsi
    ndysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvgh
    klayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtf
    layaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtna
    tsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclva
    rqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtw
    evigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfs
    keakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnet
    kfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrg
    sgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgs
    gsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyll
    ihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqc
    fslp