PDB entry 3g00

View 3g00 on RCSB PDB site
Description: Mth0212 in complex with a 9bp blunt end dsDNA at 1.7 Angstrom
Class: hydrolase/DNA
Keywords: protein-DNA complex, double-strand specific 3'-5' exonuclease, AP endonuclease, 2'-deoxyuridine endonuclease, HYDROLASE-DNA COMPLEX
Deposited on 2009-01-27, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-256)
      • engineered mutation (1)
      • engineered mutation (150)
      • expression tag (257)
    Domains in SCOPe 2.07: d3g00a1, d3g00a2
  • Chain 'B':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-256)
      • engineered mutation (150)
    Domains in SCOPe 2.07: d3g00b_
  • Chain 'H':
    Compound: 5'-d(*cp*gp*tp*ap*tp*tp*ap*cp*g)-3'
  • Chain 'I':
    Compound: 5'-d(*cp*gp*tp*ap*up*tp*ap*cp*g)-3'
  • Heterogens: PO4, GOL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g00A (A:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g00A (A:)
    avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleiell
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g00B (B:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g00B (B:)
    vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
    aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
    kyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawid
    kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
    vmgsdhcpigleiel
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.