PDB entry 3fzi

View 3fzi on RCSB PDB site
Description: 1.9 Angstrom structure of the thermophilic exonuclease III homologue Mth0212
Class: hydrolase
Keywords: alpha/beta-sandwich, double-strand specific 3'-5' exonuclease, AP endonuclease, 2'-deoxyuridine endonuclease, HYDROLASE
Deposited on 2009-01-26, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: mth0212, MTH212, MTH_212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26314 (Start-256)
      • engineered mutation (1)
      • expression tag (257-258)
    Domains in SCOPe 2.07: d3fzia1, d3fzia2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fziA (A:)
    mavlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsff
    tpaerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmsee
    rlkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpveraw
    idkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswil
    sdvmgsdhcpigleiellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fziA (A:)
    avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
    paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
    lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
    dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
    dvmgsdhcpigleielle