PDB entry 3fyy

View 3fyy on RCSB PDB site
Description: Crystal structure of divergent enolase from Oceanobacillus iheyensis complexed with Mg
Class: isomerase
Keywords: divergent enolase, NYSGXRC, target 9375a, Isomerase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2009-01-23, released 2009-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis HTE831 [TaxId:221109]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fyya1, d3fyya2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis HTE831 [TaxId:221109]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fyyb1, d3fyyb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fyyA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyyA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fyyB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyyB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswd