PDB entry 3fyi

View 3fyi on RCSB PDB site
Description: Catalytic core subunits (I and II) of cytochrome C oxidase from Rhodobacter sphaeroides in the reduced state bound with cyanide
Class: oxidoreductase
Keywords: conformational changes, cyanide binding, Cell membrane, Electron transport, Heme, Hydrogen ion transport, Ion transport, Iron, Membrane, Metal-binding, Oxidoreductase, Respiratory chain, Transmembrane, Transport
Deposited on 2009-01-22, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fyia_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • expression tag (256-259)
    Domains in SCOPe 2.07: d3fyib1, d3fyib2, d3fyib3
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fyic_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • expression tag (256-259)
    Domains in SCOPe 2.07: d3fyid1, d3fyid2, d3fyid3
  • Heterogens: HEA, CU1, MG, CA, CYN, DMU, TRD, HTO, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fyiA (A:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyiA (A:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fyiB (B:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyiB (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fyiC (C:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyiC (C:)
    wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
    lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
    nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
    ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
    gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
    mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
    pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
    igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
    gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fyiD (D:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyiD (D:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh