PDB entry 3fyg

View 3fyg on RCSB PDB site
Description: crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s-transferase
Deposited on 1997-08-07, released 1999-06-01
The last revision prior to the SCOP 1.61 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fygA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fygB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk