PDB entry 3fxo

View 3fxo on RCSB PDB site
Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 1 mM of Mn2+
Class: Hydrolase
Keywords: phosphatase, Alternative splicing, Hydrolase, Magnesium, Manganese, Metal-binding, Phosphoprotein, Protein phosphatase
Deposited on 2009-01-21, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 1A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fxoa1, d3fxoa2
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fxoA (A:)
    mgafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavyd
    ghagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkh
    gadrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnagg
    svmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdg
    iwdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspe
    avkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrnviea
    vynrlnpyknddtdststddmwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fxoA (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnvieavynrl
    npy