PDB entry 3fx7

View 3fx7 on RCSB PDB site
Description: Crystal structure of hypothetical protein of HP0062 from Helicobacter pylori
Class: unknown function
Keywords: double helix, UNKNOWN FUNCTION
Deposited on 2009-01-20, released 2009-09-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.188
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Helicobacter pylori [TaxId:210]
    Gene: hp0062, HP_0062
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24902 (Start-85)
      • expression tag (86-87)
    Domains in SCOPe 2.03: d3fx7a_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Helicobacter pylori [TaxId:210]
    Gene: hp0062, HP_0062
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24902 (Start-85)
      • expression tag (86-90)
    Domains in SCOPe 2.03: d3fx7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fx7A (A:)
    msrvqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkst
    fnefdeaaqeqiawlkerirvleedylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fx7A (A:)
    qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef
    deaaqeqiawlkerirvleedyle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fx7B (B:)
    msrvqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkst
    fnefdeaaqeqiawlkerirvleedylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fx7B (B:)
    qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef
    deaaqeqiawlkerirvleedylehhh