PDB entry 3fwe

View 3fwe on RCSB PDB site
Description: Crystal Structure of the Apo D138L CAP mutant
Class: transcription regulator
Keywords: helix-turn-helix, transcription, cAMP, allostery, Acetylation, Activator, cAMP-binding, DNA-binding, Nucleotide-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-01-17, released 2009-09-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3357, cap, crp, csm, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered (138)
    Domains in SCOPe 2.03: d3fwea1, d3fwea2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3357, cap, crp, csm, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered (138)
    Domains in SCOPe 2.03: d3fweb1, d3fweb2
  • Heterogens: PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fweA (A:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fweA (A:)
    qtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyln
    qgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlq
    vtsekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgr
    ilkmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fweB (B:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fweB (B:)
    qtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyln
    qgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlq
    vtsekvgnlafllvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgr
    ilkmledqnlisahgktivvygt