PDB entry 3fvd

View 3fvd on RCSB PDB site
Description: Crystal structure of a member of enolase superfamily from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, HYDROLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-01-15, released 2009-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.167
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14065
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF7 (3-369)
      • expression tag (1-2)
      • expression tag (370)
    Domains in SCOPe 2.06: d3fvda1, d3fvda2, d3fvda3, d3fvda4
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14065
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF7 (3-369)
      • expression tag (1-2)
      • expression tag (370)
    Domains in SCOPe 2.06: d3fvdb1, d3fvdb2, d3fvdb3, d3fvdb4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fvdA (A:)
    mslritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsyl
    pahgpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvag
    lplwqllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiari
    eaisaglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpi
    mldeclhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggta
    ladtaalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpe
    algrpvasydeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fvdA (A:)
    slritrltvfhldlplakpfdrldstylridtdegvtgwgegcpwghsylpahgpglrag
    iatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwqllgge
    aatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieaisaglpdg
    hrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimldeclhefs
    dhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtaladtaalhla
    astpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealgrpvasyd
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fvdB (B:)
    mslritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsyl
    pahgpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvag
    lplwqllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiari
    eaisaglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpi
    mldeclhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggta
    ladtaalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpe
    algrpvasydeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fvdB (B:)
    slritrltvfhldlplakpywlslkfdrldstylridtdegvtgwgegcpwghsylpahg
    pglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplw
    qllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieais
    aglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimlde
    clhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtaladt
    aalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealgr
    pvasyde