PDB entry 3fvb

View 3fvb on RCSB PDB site
Description: Crystal structure of ferritin (bacterioferritin) from Brucella melitensis
Class: metal binding protein
Keywords: NIAID, SSGCID, deCODE, ferritin, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, METAL BINDING PROTEIN
Deposited on 2009-01-15, released 2009-02-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-03, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: bfr, BAB2_0675
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YKI4 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.04: d3fvba_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: bfr, BAB2_0675
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YKI4 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.04: d3fvbb_
  • Heterogens: HEM, FE, MG, NA, CL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fvbA (A:)
    mahhhhhhmgtleaqtqgpgsmkgepkvierlnealflelgavnqywlhyrllndwgytr
    lakkereesieemhhadklidriiflegfpnlqtvsplrigqnvkevleadlkgeydara
    sykesreicdklgdyvskqlfdelladeeghidfletqldllakiggerygqlnaapade
    ae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fvbA (A:)
    gsmkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadkl
    idriiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskq
    lfdelladeeghidfletqldllakiggerygqlnaapade
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fvbB (B:)
    mahhhhhhmgtleaqtqgpgsmkgepkvierlnealflelgavnqywlhyrllndwgytr
    lakkereesieemhhadklidriiflegfpnlqtvsplrigqnvkevleadlkgeydara
    sykesreicdklgdyvskqlfdelladeeghidfletqldllakiggerygqlnaapade
    ae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fvbB (B:)
    gsmkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadkl
    idriiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskq
    lfdelladeeghidfletqldllakiggerygqlnaapade