PDB entry 3fv9

View 3fv9 on RCSB PDB site
Description: Crystal structure of putative mandelate racemase/muconatelactonizing enzyme from ROSEOVARIUS NUBINHIBENS ISM complexed with magnesium
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, MANDELATE RACEMASE/MUCONATELACTONIZING ENZYME, HYDROLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-01-15, released 2009-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9a1, d3fv9a2, d3fv9a3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9b1, d3fv9b2, d3fv9b3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9c1, d3fv9c2, d3fv9c3
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9d1, d3fv9d2, d3fv9d3
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9e1, d3fv9e2, d3fv9e3
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9f1, d3fv9f2, d3fv9f3
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9g1, d3fv9g2, d3fv9g3
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens ISM [TaxId:89187]
    Gene: ISM_14080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNG0 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fv9h1, d3fv9h2, d3fv9h3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fv9A (A:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9A (A:)
    lkitridihrtdlpvrghsydativsietdtgltgwgestpfgstyiaahaggtraalel
    lapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglplcdmtggrvag
    pvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacladrqp
    gewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllldeliq
    tetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisfaail
    hlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgtpvkt
    fgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fv9B (B:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9B (B:)
    lkitridihrtdlpvrggeyhsydativsietdtgltgwgestpfgstyiaahaggtraa
    lellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglplcdmtggr
    vagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritaclad
    rqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalplllde
    liqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisfa
    ailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgtp
    vktfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fv9C (C:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9C (C:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfgd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fv9D (D:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9D (D:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fv9E (E:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9E (E:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fv9F (F:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9F (F:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fv9G (G:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9G (G:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fv9H (H:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fv9H (H:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktfgd