PDB entry 3fur

View 3fur on RCSB PDB site
Description: Crystal Structure of PPARg in complex with INT131
Class: TRANSCRIPTION/Transcription regulator
Keywords: nuclear receptor, PPARgamma, X-ray, crystal structure, partial agonist, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, INT131, TRANSCRIPTION/Transcription regulator COMPLEX
Deposited on 2009-01-14, released 2009-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARgamma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fura_
  • Chain 'H':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: Z12, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3furA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3furA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgkevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgll
    nvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktet
    dmslhpllqeiykdly
    

  • Chain 'H':
    No sequence available.