PDB entry 3fuq

View 3fuq on RCSB PDB site
Description: Glycosylated SV2 and Gangliosides as Dual Receptors for Botulinum Neurotoxin Serotype F
Class: toxin
Keywords: Botulinum Neurotoxin, Ganglioside, SV2, receptor binding, Neurotoxin
Deposited on 2009-01-14, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BoNT/F (Neurotoxin type F)
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/f, Botulinum Neurotoxin F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fuqa1, d3fuqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fuqA (A:)
    lykkikdnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaq
    nndiiyngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtl
    qdtagnnqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdi
    hvsdnilfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllyn
    kryyllnllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirkngstdisn
    tdnfvrkndlayinvvdrdveyrlyadisiakpekiiklirtsnsnnslgqiivmdsign
    nctmnfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fuqA (A:)
    dnsildmryennkfidisgygsnisingdvyiystnrnqfgiysskpsevniaqnndiiy
    ngryqnfsisfwvripkyfnkvnlnneytiidcirnnnsgwkislnynkiiwtlqdtagn
    nqklvfnytqmisisdyinkwifvtitnnrlgnsriyingnlideksisnlgdihvsdni
    lfkivgcndtryvgiryfkvfdtelgkteietlysdepdpsilkdfwgnyllynkryyll
    nllrtdksitqnsnflninqqrgvyqkpnifsntrlytgveviirknntdnfvrkndlay
    invvdrdveyrlyadisiakpekiiklirtlgqiivmdsignnctmnfqnnnggnigllg
    fhsnnlvasswyynnirkntssngcfwsfiskehgwqen