PDB entry 3fuo

View 3fuo on RCSB PDB site
Description: The Crystal structure of receptor binding domain of botulinum neurotoxin serotype A
Class: hydrolase
Keywords: Botulinum Neurotoxin, Ganglioside Binding, Hydrolase, Membrane, Metal-binding, Metalloprotease, Neurotoxin, Pharmaceutical, Protease, Secreted, Toxin, Transmembrane, Zinc
Deposited on 2009-01-14, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: atx, bna, botA, Botulinum Neurotoxin A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fuoa1, d3fuoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fuoA (A:)
    kniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkn
    aivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdt
    qeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihas
    nnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkp
    yymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnk
    dnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndqg
    itnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipvddg
    wgerpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fuoA (A:)
    tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
    smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
    rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
    kldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqydkpyymln
    lydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgtkfiikkyasgnkdnivr
    nndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmksknitnkckmn
    lqdnngndigfigfhqfnniaklvasnwynrqiersslgcswefipvddgwgerpl