PDB entry 3ft8

View 3ft8 on RCSB PDB site
Description: Structure of HSP90 bound with a noval fragment.
Class: chaperone
Keywords: Hsp90 N-terminal nucleotide binding domain, Alternative splicing, ATP-binding, Chaperone, Cytoplasm, Nucleotide-binding, Phosphoprotein, Stress response
Deposited on 2009-01-12, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ft8a_
  • Heterogens: MOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ft8A (A:)
    mgsshhhhhhssglvprgshmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflre
    lisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnl
    gtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessag
    gsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerd
    kevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ft8A (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdepmgrgtkvilhlkedqtey
    leerrikeivkkhsqfigypitlfve