PDB entry 3fs1

View 3fs1 on RCSB PDB site
Description: Crystal structure of HNF4a LBD in complex with the ligand and the coactivator PGC-1a fragment
Class: transcription
Keywords: Nuclear Receptor, Coactivator, LXXLL motif, MODY, Diabetes, Alternative promoter usage, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2009-01-08, released 2009-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte nuclear factor 4-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HNF4, HNF4A, NR2A1, TCF14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fs1a_
  • Chain 'B':
    Compound: PPARgamma Coactivator-1a (PGC-1a)
    Species: Homo sapiens [TaxId:9606]
    Gene: PGC-1a
    Database cross-references and differences (RAF-indexed):
    • PDB 3FS1 (0-8)
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fs1A (A:)
    slpsinallqaevlsrqitspvsgingdirakkiasiadvcesmkeqllvlvewakyipa
    fcelplddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsir
    ildelvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrq
    ydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllgg
    

  • Chain 'B':
    No sequence available.