PDB entry 3fru

View 3fru on RCSB PDB site
Description: neonatal fc receptor, ph 6.5
Class: complex (immunoglobulin/binding protein)
Keywords: COMPLEX (IMMUNOGLOBULIN-BINDING PROTEIN), COMPLEX (IMMUNOGLOBULIN-BINDING PROTEIN) complex
Deposited on 1997-12-22, released 1998-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neonatal fc receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3frua1, d3frua2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3frub_
  • Chain 'C':
    Compound: neonatal fc receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fruc1, d3fruc2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3frud_
  • Chain 'E':
    Compound: neonatal fc receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3frue1, d3frue2
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GLUTAMINE SYNTHETASE SELECTION
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fruf_
  • Heterogens: NAG, SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruA (A:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruC (C:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruD (D:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruE (E:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruF (F:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm