PDB entry 3frg

View 3frg on RCSB PDB site
Description: Catalytic Domain of Human Phosphodiesterase 4B2B in Complex with a Quinoline Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: PDE, PHOSPHODIESTERASE, cAMP, Alternative splicing, Hydrolase, Phosphoprotein, Polymorphism, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2009-01-08, released 2010-01-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343
      • engineered (331)
      • engineered (336)
    Domains in SCOPe 2.05: d3frga_
  • Heterogens: SK4, ZN, MG, ARS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3frgA (A:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqamipqapappldeqnrdcqglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3frgA (A:)
    isrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfris
    sdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaa
    ihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrq
    tlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcad
    lsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivh
    plwetwadlvqpdaqdildtlednrnwyqamipqa