PDB entry 3fou

View 3fou on RCSB PDB site
Description: Low pH structure of the Rieske protein from Thermus thermophilus at 2.1 A
Class: electron transport
Keywords: Rieske protein, Pr, [2Fe-2S], ELECTRON TRANSPORT
Deposited on 2009-01-02, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TTHA1931
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SGZ9 (0-155)
  Domains in SCOPe 2.06: d3foua_
• Chain 'B':
  Compound: Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TTHA1931
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SGZ9 (0-155)
  Domains in SCOPe 2.06: d3foub_
• Heterogens: FES, PR, CA, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fouA (A:)
  tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
  arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
  viagppprpvpqlpvrvedgvlvaageflgpvgvqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fouB (B:)
  tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
  arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
  viagppprpvpqlpvrvedgvlvaageflgpvgvqa