PDB entry 3fo0

View 3fo0 on RCSB PDB site
Description: Crystal structure of hapten complex of catalytic elimination antibody 13G5 (wild-type)
Class: immune system
Keywords: IMMUNOGLOBULIN, CATALYTIC ANTIBODY, CHIMERIC FAB, HAPTEN COMPLEX, ACID BASE CATALYSIS, PROTON TRANSFER, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-12-27, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Catalytic antibody Fab 13G5 IgG2b heavy chain chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO0 (0-End)
  • Chain 'L':
    Compound: Catalytic antibody Fab 13G5 kappa light chain chimera
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO0 (0-End)
    Domains in SCOPe 2.06: d3fo0l1, d3fo0l2
  • Heterogens: BZH, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3fo0L (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fo0L (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr