PDB entry 3fmg

View 3fmg on RCSB PDB site
Description: Structure of rotavirus outer capsid protein VP7 trimer in complex with a neutralizing Fab
Class: immune system
Keywords: antibody-antigen complex, calcium dependent trimer, antiparallel beta-sandwich, jelly roll, alpha-beta-alpha sandwich, Rossmann fold, Capsid protein, Endoplasmic reticulum, Glycoprotein, Membrane, Transmembrane, Virion, IMMUNE SYSTEM
Deposited on 2008-12-22, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.224
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein VP7
    Species: Simian rotavirus [TaxId:10922]
    Gene: S9, VP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12476
      • see remark 999 (120)
  • Chain 'H':
    Compound: Fab of neutralizing antibody 4F8, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FMG (0-220)
  • Chain 'L':
    Compound: Fab of neutralizing antibody 4F8, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FMG (0-210)
    Domains in SCOPe 2.07: d3fmgl1, d3fmgl2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fmgL (L:)
diqmtqspaslsasvgetvtitcrpseniysylawyqqkqgkspqllvykaktlpegvps
rfsgsgsgthfslkissvqpedfgtyycqhhngppltfgagtklelkradaaptvsifpp
sskqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnr