PDB entry 3fm9

View 3fm9 on RCSB PDB site
Description: Analysis of the Structural Determinants Underlying Discrimination between Substrate and Solvent in beta-Phosphoglucomutase Catalysis
Class: isomerase
Keywords: HAD superfamily, phosphoaspartate, induced fit, domain movement, Isomerase
Deposited on 2008-12-19, released 2009-06-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Lactococcus lactis subsp. lactis [TaxId:1360]
    Gene: L0001, LL0429, pgmB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • engineered (15)
      • variant (124)
      • variant (205)
    Domains in SCOPe 2.01: d3fm9a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fm9A (A:)
    mfkavlfdldgvitdpaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fm9A (A:)
    mfkavlfdldgvitdpaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkq