PDB entry 3fju

View 3fju on RCSB PDB site
Description: Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase A1
Class: hydrolase/hydrolase inhibitor
Keywords: Ascariasis, host resistance, metallocarboxypeptidase inhibitor, immunolocalization, Carboxypeptidase, Hydrolase, Metal-binding, Metalloprotease, Protease, Secreted, Zymogen, Metalloenzyme inhibitor, Metalloprotease inhibitor, Protease inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2008-12-15, released 2008-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: CPA1, CPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fjua_
  • Chain 'B':
    Compound: Carboxypeptidase A inhibitor
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19399 (0-62)
      • see remark 999 (58-64)
  • Heterogens: ZN, NA, CAC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fjuA (A:)
rstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpa
iwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafths
tnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivd
fvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnyg
siikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltim
ehtlnhp

  • Chain 'B':
    No sequence available.