PDB entry 3fjt

View 3fjt on RCSB PDB site
Description: Crystal structure of a human Fc fragment engineered for extended serum half-life
Class: immune system
Keywords: Fc, IgG1, FcRn binding, CH3-CH3 association, Glycoprotein, Immunoglobulin C region, Immunoglobulin domain, Secreted, IMMUNE SYSTEM
Deposited on 2008-12-15, released 2009-03-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IgG1, IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-208)
      • engineered (16)
      • engineered (18)
      • engineered (20)
    Domains in SCOPe 2.04: d3fjta1, d3fjta2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IgG1, IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-208)
      • engineered (16)
      • engineered (18)
      • engineered (20)
    Domains in SCOPe 2.04: d3fjtb1, d3fjtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fjtA (A:)
    ggpsvflfppkpkdtlyitrepevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fjtB (B:)
    ggpsvflfppkpkdtlyitrepevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls