PDB entry 3fj4

View 3fj4 on RCSB PDB site
Description: Crystal structure of muconate lactonizing enzyme from Pseudomonas Fluorescens complexed with muconolactone
Class: isomerase
Keywords: muconate lactonizing enzyme, cis, cis-muconate, Isomerase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-12-14, released 2009-03-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3fj4a1, d3fj4a2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3fj4b1, d3fj4b2
  • Heterogens: MUC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fj4A (A:)
    mslhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttiggla
    ygnespdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgk
    rlglpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrd
    lahviaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrl
    nasspapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagigly
    ggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapgl
    glsldeerlaffrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fj4A (A:)
    hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
    espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
    lpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlah
    viaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnas
    spapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggt
    mleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglgls
    ldeerlaffrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fj4B (B:)
    mslhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttiggla
    ygnespdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgk
    rlglpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrd
    lahviaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrl
    nasspapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagigly
    ggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapgl
    glsldeerlaffrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fj4B (B:)
    hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
    espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
    lpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlah
    viaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnas
    spapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggt
    mleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglgls
    ldeerlaffrr