PDB entry 3fib

View 3fib on RCSB PDB site
Description: recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0: a further refinement of pdb entry 1fib, and differs from 1fib by the modelling of a cis peptide bond between residues k338 and c339
Deposited on 1997-07-14, released 1997-09-17
The last revision prior to the SCOP 1.57 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.154
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d3fib__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fib_ (-)
  qihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvd
  fkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadya
  mfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfe
  gncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkktt
  mkiipfnrl