PDB entry 3fia

View 3fia on RCSB PDB site
Description: Crystal structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646e.
Class: protein binding
Keywords: Intersectin-1; EH 1 domain; NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Alternative splicing, Calcium, Cell junction, Cell projection, Coiled coil, Endocytosis, Membrane, Phosphoprotein, SH3 domain, Synapse, Synaptosome, PROTEIN BINDING
Deposited on 2008-12-11, released 2008-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-30, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intersectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ITSN, ITSN1, SH3D1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15811
      • engineered (23)
    Domains in SCOPe 2.06: d3fiaa_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fiaA (A:)
    mghhhhhhshvaqfptpfggsldtwaitveerakhdqqfhslkpisgfitgdqarnfffq
    sglpqpvlaqiwaladmnndgrmdqvefsiamkliklklqgyqlpsalppvmkqqpvais
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fiaA (A:)
    tpfggsldtwaitveerakhdqqfhslkpisgfitgdqarnfffqsglpqpvlaqiwala
    dmnndgrmdqvefsiamkliklklqgyqlpsalppvmk