PDB entry 3fi9

View 3fi9 on RCSB PDB site
Description: Crystal structure of malate dehydrogenase from Porphyromonas gingivalis
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, OXIDOREDUCTASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-12-11, released 2008-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.254
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1880
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RM04 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3fi9a1, d3fi9a2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Porphyromonas gingivalis [TaxId:431947]
    Gene: PGN_1880
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RM04 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.05: d3fi9b1, d3fi9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fi9A (A:)
    mslsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfe
    glnltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdck
    hviiifnpaditglvtliysglkpsqvttlagldstrlqselakhfgikqslvtntrtyg
    ghgeqmavfastakvngtpltdligtdkltneqwaelkqrvvkgganiiklrgrssfqsp
    syvsiemiraamggeafrwpagcyvnvpgfehimmamettitkdgvkhsdinqlgneaer
    aalkesyshlaklrdeviamgiipaiadwktvnpneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fi9A (A:)
    slsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfeg
    lnltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnp
    aditglvtliysglkpsqvttlagldstrlqselakhfgikqslvtntrtygghgeqmav
    fastakvngtpltdligtdkltneqwaelkqrvvkgganiiklrgrssfqspsyvsiemi
    raamggeafrwpagcyvnvpgfehimmamettitkdgvkhsdinqlgneaeraalkesys
    hlaklrdeviamgiipaiadw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fi9B (B:)
    mslsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfe
    glnltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdck
    hviiifnpaditglvtliysglkpsqvttlagldstrlqselakhfgikqslvtntrtyg
    ghgeqmavfastakvngtpltdligtdkltneqwaelkqrvvkgganiiklrgrssfqsp
    syvsiemiraamggeafrwpagcyvnvpgfehimmamettitkdgvkhsdinqlgneaer
    aalkesyshlaklrdeviamgiipaiadwktvnpneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fi9B (B:)
    lsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegl
    nltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnpa
    ditglvtliysglkpsqvttlagldstrlqselakhfgikqslvtntrtygghgeqmavf
    astakvngtpltdligtdkltneqwaelkqrvvkgganiiklrgrssfqspsyvsiemir
    aamggeafrwpagcyvnvpgfehimmamettitkdgvkhsdinqlgneaeraalkesysh
    laklrdeviamgiipaiadw