PDB entry 3fi6

View 3fi6 on RCSB PDB site
Description: apo-H49AFr with high content of Pd ions
Class: metal binding protein
Keywords: Iron storage, light chain apoferritin, Metal binding protein
Deposited on 2008-12-11, released 2009-04-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene: FTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791
      • engineered (48)
      • see remark 999 (92)
    Domains in SCOPe 2.02: d3fi6a_
  • Heterogens: PD, CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fi6A (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvcaffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fi6A (A:)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvcaffrelaeekreg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh