PDB entry 3fg5

View 3fg5 on RCSB PDB site
Description: Crystal structure determination of a ternary complex of phospholipase A2 with a pentapetide FLSYK and Ajmaline at 2.5 A resolution
Class: hydrolase
Keywords: pla2, pentapeptide, FLSYK, ajmaline, ternary complex, HYDROLASE
Deposited on 2008-12-05, released 2008-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group II Phospholipase A2
    Species: Daboia russelli pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FG5 (0-120)
    Domains in SCOPe 2.08: d3fg5a_
  • Chain 'C':
    Compound: pentapetide FLSYK
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FG5 (0-4)
  • Heterogens: AJM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fg5A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'C':
    No sequence available.