PDB entry 3fft

View 3fft on RCSB PDB site
Description: Crystal Structure of CheY double mutant F14E, E89R complexed with BeF3- and Mn2+
Class: signaling protein
Keywords: Response Regulator, Receiver Domain, BeF3, Two-Component Signal Transduction, Chemotaxis, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2008-12-04, released 2009-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.163
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:83333]
  Gene: b1882, cheY, JW1871
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered (12)
    • engineered (87)
  Domains in SCOPe 2.06: d3ffta_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:83333]
  Gene: b1882, cheY, JW1871
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered (12)
    • engineered (87)
  Domains in SCOPe 2.06: d3fftb_
• Heterogens: MN, BEF, GOL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fftA (A:)
  adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fftB (B:)
  adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm