PDB entry 3ffd

View 3ffd on RCSB PDB site
Description: Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Class: immune system/hormone
Keywords: pthrp complexed to fab, Alternative splicing, Calcium, Cleavage on pair of basic residues, Cytoplasm, Hormone, Nucleus, Polymorphism, Secreted, IMMUNE SYSTEM/HORMONE COMPLEX
Deposited on 2008-12-03, released 2009-04-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoclonal antibody, heavy chain, Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FFD (0-217)
  • Chain 'B':
    Compound: Monoclonal antibody, light chain, Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FFD (0-End)
    Domains in SCOPe 2.03: d3ffdb1, d3ffdb2
  • Chain 'P':
    Compound: parathyroid hormone-related protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ffdB (B:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmdlkqdgshstgd
    gipdrfsgsssgadrylsisniqpedeamyicgvgdtikeqfvyvfgggtkvtvlgepks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspaecl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ffdB (B:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmdlkqdgshstgd
    gipdrfsgsssgadrylsisniqpedeamyicgvgdtikeqfvyvfgggtkvtvlgepks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspa
    

  • Chain 'P':
    No sequence available.