PDB entry 3ff9
View 3ff9 on RCSB PDB site
Description: Structure of NK cell receptor KLRG1
Class: immune system
Keywords: Natural Killer cell receptor KLTG1, Glycoprotein, Lectin, Membrane, Phosphoprotein, Receptor, Signal-anchor, Transmembrane, IMMUNE SYSTEM
Deposited on
2008-12-02, released
2009-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-07-28, with a file datestamp of
2009-07-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Killer cell lectin-like receptor subfamily G member 1
Species: Mus musculus [TaxId:10090]
Gene: Klrg1, Mafa
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3ff9a1, d3ff9a2 - Chain 'B':
Compound: Killer cell lectin-like receptor subfamily G member 1
Species: Mus musculus [TaxId:10090]
Gene: Klrg1, Mafa
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3ff9b1, d3ff9b2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ff9A (A:)
mcpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywi
glrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ff9B (B:)
mcpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywi
glrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly