PDB entry 3ff8

View 3ff8 on RCSB PDB site
Description: Structure of NK cell receptor KLRG1 bound to E-cadherin
Class: Cell Adhesion/Immune System
Keywords: KLRG1-cadherin complex, Calcium, Cell adhesion, Cell junction, Cell membrane, Cleavage on pair of basic residues, Disease mutation, Glycoprotein, Membrane, Phosphoprotein, Polymorphism, Transmembrane, Lectin, Receptor, Signal-anchor, Cell Adhesion/Immune System COMPLEX
Deposited on 2008-12-02, released 2009-07-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial cadherin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12830 (1-100)
      • expression tag (0)
      • engineered (9)
    Domains in SCOPe 2.03: d3ff8a_
  • Chain 'B':
    Compound: epithelial cadherin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12830 (1-End)
      • expression tag (0)
      • engineered (9)
    Domains in SCOPe 2.03: d3ff8b_
  • Chain 'C':
    Compound: Killer cell lectin-like receptor subfamily G member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Klrg1, Mafa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ff8c_
  • Chain 'D':
    Compound: Killer cell lectin-like receptor subfamily G member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Klrg1, Mafa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ff8d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ff8A (A:)
    mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw
    lkvtepldreriatytlfshavssngnavedpmeilitvtd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ff8B (B:)
    mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw
    lkvtepldreriatytlfshavssngnavedpmeilitvtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ff8B (B:)
    mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw
    lkvtepldreriatytlfshavssngnavedpmeilitvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ff8C (C:)
    cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
    lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ff8C (C:)
    cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
    lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ff8D (D:)
    cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
    lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ff8D (D:)
    cpilwtrngshcyyfsmekkdwnsslkfcadkgshlltfpdnqgvklfgeylgqdfywig
    lrnidgwrweggpalslriltnsliqrcgaihrnglqasscevalqwickkvl